PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_015450-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB_related
Protein Properties Length: 392aa    MW: 43774.1 Da    PI: 5.7344
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_015450-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.51.7e-142468348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      WT+eEd++l + +  +G+++W+ Ia+++   +t  qc+ rw++yl
  AHYPO_015450-RA 24 TWTQEEDDILREQISIHGTENWTIIASKFK-DKTTRQCRRRWYTYL 68
                     6****************************9.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.1521772IPR017930Myb domain
SMARTSM007171.1E-132170IPR001005SANT/Myb domain
CDDcd001671.24E-132468No hitNo description
SuperFamilySSF466899.58E-182498IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-192583IPR009057Homeodomain-like
PfamPF139213.9E-152583No hitNo description
PROSITE profilePS500904.00869103IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MTTLQKQEIN EDSSSKPKER RIVTWTQEED DILREQISIH GTENWTIIAS KFKDKTTRQC  60
RRRWYTYLNS DFKKGGWSPE EDMLTDNAVK NRFSTLCKKK AKREALAKEN TNGFINVNNK  120
RILIENNGFH SQSTMKIESP LKKLRRAHIP NPAENFNSGN ILLEGCGLSK QHPRLPFAVL  180
AQNARNADNN SIVSSVMDTL INGDEKLDGA CFRKDDPKVA ALMQQAELLS SLAVKLDDLK  240
DFMDNLRCSN EESQPSQRQP DLYESPSSSE YSTGSTNLSA CDQGEHSQAE ISTLHEELGV  300
TAQSVQMADN GCVDITEDKL LPCGTTDQEF SSPIQVTPLF RSLASAIPSP QFSESERHFL  360
LKTLGIESPA QNTITNPLEP PPCRKALLQG L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-142510010107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010683232.10.0PREDICTED: uncharacterized protein LOC104897953
RefseqXP_010683234.10.0PREDICTED: uncharacterized protein LOC104897953
TrEMBLA0A0K9RRN20.0A0A0K9RRN2_SPIOL; Uncharacterized protein
STRINGVIT_01s0026g01910.t011e-139(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.22e-97myb domain protein 88